PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G000600.2.p
Common NameGLYMA_04G000600, LOC100787220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 786aa    MW: 86862.9 Da    PI: 5.5255
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G000600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.41.4e-28515566152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Glyma.04G000600.2.p 515 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 566
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.257505586IPR003035RWP-RK domain
PfamPF020423.7E-24519566IPR003035RWP-RK domain
SuperFamilySSF542772.64E-23677772No hitNo description
Gene3DG3DSA:3.10.20.2404.7E-22686767No hitNo description
PROSITE profilePS5174523.9687770IPR000270PB1 domain
PfamPF005643.8E-16687769IPR000270PB1 domain
SMARTSM006662.1E-26687770IPR000270PB1 domain
CDDcd064072.56E-39688769No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MEYGGLVQNS AYGSFSEIFG PETDFIDELF VEGCWVETRV GSYLNCGGEA NSSKPNTMAS  60
METSAQIIFQ EESLSDPEIS LMVGKRWWIG PRENPGPSSS VKERLVIAVG YLKEYAKNSN  120
LLIQVWVPER RRSARAQPQD NYPYAALLNT TSAFQFQEDW VHDQWTPNIR FFRSHEYPRH  180
LRRPGSLALP VFESGSAMCL GVVEILMPNN PDLHALQSVD FTSSTCHQNF IPPAAVTAKG  240
FDELYQSALN EIVEVLTCVC KAHNLPLALT WAPCIQQGKS GCGHSNDENY VSIVDPASFV  300
ADVEVLGFLE ACSECHLLGG QGVVGTAFTT TKPCFANDIT AFSKAEYPLA HHANMFGLHA  360
AVAIPLLSDS ADFVLEFFLP KDCHDTQEQK QMLNSLSMLV QQACRSLHVV MGKEEEEEEE  420
EEELIALPPV GKEMESSSSS SWIAHMMEAQ QKGKGVSVSL EYLQEPKQEF RVTTNCNEQV  480
SVGVESGGGE ESYTAAFGGR RGARKSAGDK RRTKAEKTIS LPVLRQYFAG SLKDAAKSIG  540
VCPTTLKRIC RQHGITRWPS RKIKKVGHSL RKLQLVIDSV QGAEGAIQIG SFYTSFPELS  600
SANGVSESSN INNKFFSEYN QGATTFKSPT SPCSQTTILI SENQQPLVLG ASIQVQEEAK  660
HFAHHLEPLP PAPLPQSSTS LWNTAGTFRV KATFGDEKIR FSLQPNWGFR DLQMEIARRF  720
NLNEISNIQL KYLDDAREWV LLTCDADLDE CKDINTSSQS RTIRLFLFQA SPLNHANAFR  780
GTSPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-162AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523488.10.0PREDICTED: protein NLP2-like
RefseqXP_014629858.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLK7KHB30.0K7KHB3_SOYBN; Uncharacterized protein
STRINGGLYMA04G00210.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein